PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00996.1.g00150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 565aa    MW: 59892.1 Da    PI: 8.8725
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00996.1.g00150.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.58.3e-1080115137
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37 
                                   rg W + Ed +l ++v+++G+ +W++Ia+++  gR++
  Zmw_sc00996.1.g00150.1.am.mk  80 RGHWRPAEDAKLRELVALYGPQNWNLIAEKLD-GRSG 115
                                   899*****************************.**98 PP

2Myb_DNA-binding51.42.5e-16165207246
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                    +++ eE+e+l  a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Zmw_sc00996.1.g00150.1.am.mk 165 RPFSDEEEERLMAAHRFYGNK-WAMIARLFP-GRTDNAVKNHWHV 207
                                   689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.45575130IPR017930Myb domain
SuperFamilySSF466897.9E-878118IPR009057Homeodomain-like
SMARTSM007170.003479160IPR001005SANT/Myb domain
PfamPF002496.9E-980116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2281114IPR009057Homeodomain-like
CDDcd001672.13E-783115No hitNo description
Gene3DG3DSA:1.10.10.602.3E-22147165IPR009057Homeodomain-like
SuperFamilySSF466894.71E-21147217IPR009057Homeodomain-like
PROSITE profilePS5129424.91159213IPR017930Myb domain
SMARTSM007174.9E-13163211IPR001005SANT/Myb domain
PfamPF002491.5E-12164206IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-20166212IPR009057Homeodomain-like
CDDcd001672.03E-10166206No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MPCSSPPPPW LLHLGSAAAD QASSSTSSRG GGRVLTGGTT TMDTGATAGG GAGGGGGVGG  60
GNAADHQESS SSGQSRLAAR GHWRPAEDAK LRELVALYGP QNWNLIAEKL DGRSGACVRV  120
PSLAFRVRFR STIPSAFCFA STDWIIGKSC RLRWFNQLDP RISKRPFSDE EEERLMAAHR  180
FYGNKWAMIA RLFPGRTDNA VKNHWHVIMA RKYREQSTAY RRRKLNQAVQ RKLEAAATAT  240
ASALPPSAAG DVVVGHHHHL LAAHDAAACF GDPYGAFALR HYCSFPFPGA AEEPLPPFCL  300
FPALARPASP LQADCSTYIH RIVVVVVVVR DMPTHNGSPH WAAHGGPVRP LLLAAMYPGV  360
NALLEIGSDG RSETMAMRHH QYGGLPPLCL LLFTLEISPS RYLDLSSVVL VCHCDVAFSS  420
LFRPSAAPAD TRLLPWQHQH QQPPPPGAAG RAVVVNGPSA APADTRLLPW QHQHQQPPPP  480
GAAGRAVVVN GRYGPAEPPL LVPLPVPGAW MGGHHLEPPF ISEPAAAAAF DGGATREGAG  540
ARFESTAAAA AAAPAFIDFL GVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27802127107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0LV691e-110A0A0E0LV69_ORYPU; Uncharacterized protein
STRINGGRMZM2G428555_P031e-102(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260